PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20866.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 159aa    MW: 18028.2 Da    PI: 9.6426
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20866.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-171559147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
        PK20866.1 15 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 59
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.86E-18965IPR009057Homeodomain-like
PROSITE profilePS5129421.0911064IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-91261IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-181362IPR006447Myb domain, plants
SMARTSM007177.3E-131462IPR001005SANT/Myb domain
PfamPF002493.2E-141558IPR001005SANT/Myb domain
CDDcd001674.22E-101760No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
XIIKTRKPYT ITKQRERWTE EEHNRFLEAL KLYGRAWQRI EEHIGTKTAV QIRSHAQKFF  60
SKLEKEALVK GVPVGRAIDI DIPPPRPKRK PSNPYPRKTG VGPLTSQVGG KDEKYLSESS  120
SHCKQVLDLE KEPVLEGPDG DGKPTQAKEN HDDDCSGLT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301448.22e-77hypothetical protein POPTR_0002s18190g
SwissprotQ6R0H15e-56LHY_ARATH; Protein LHY
TrEMBLB9GRS12e-77B9GRS1_POPTR; Uncharacterized protein
STRINGVIT_15s0048g02410.t012e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.48e-48MYB_related family protein